Heterocephalus glaber (naked mole-rat): 101722241 Help Entry 101722241         CDS       T02812                                  Symbol Pfn3, Profilin-3 Name (RefSeq) profilin 3   KO K05759   profilin Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04015   Rap1 signaling pathway hgl04810   Regulation of actin cytoskeleton hgl05014   Amyotrophic lateral sclerosis hgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101722241 (Pfn3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101722241 (Pfn3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101722241 (Pfn3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101722241 (Pfn3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hgl04131]     101722241 (Pfn3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hgl04812]     101722241 (Pfn3)    04147 Exosome [BR:hgl04147]     101722241 (Pfn3) Membrane trafficking [BR:hgl04131]  Others   Actin-binding proteins    Others     101722241 (Pfn3) Cytoskeleton proteins [BR:hgl04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101722241 (Pfn3) Exosome [BR:hgl04147]  Exosomal proteins   Proteins found in most exosomes    101722241 (Pfn3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101722241 NCBI-ProteinID:  XP_004836319 UniProt:  G5BQ08 LinkDB All DBs Position Un AA seq 137 aa AA seqDB search MGEWKGFISAVLRDQSIEDVAVVGHSNNCCVWASRPGGLLAAISPQEVGVLTGADRHTFL QTGLCLAGCPCCVIRDNLLAEGDGVLDAHTKGLDRRAFCVGHTPRLLLVFMGRQGVHGGM LNKKMHELTRRLCLQGL NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgagtggaagggcttcatcagtgcggtgctgcgggaccagagcatcgaggacgtg gccgtcgtgggccactcgaacaattgctgcgtgtgggcgtcgcggccggggggcctgctg gctgccatctccccgcaggaggtgggcgtgctcacgggggccgaccggcacaccttcctg cagactggcctgtgcttggcgggctgcccctgctgtgtcatccgtgacaacctgctggcc gagggcgatggcgtgttggacgcgcacaccaaggggctggacaggcgcgccttctgcgtg ggccacacgccgcgcttgctcctcgtgttcatgggtcggcagggcgtgcacgggggcatg ctcaacaagaagatgcacgagctgacccgcaggctgtgcctgcagggcttgtag

DBGET integrated database retrieval system