Heterocephalus glaber (naked mole-rat): 101725085 Help Entry 101725085         CDS       T02812                                  Symbol Pgf Name (RefSeq) placental growth factor   KO K16859   placenta growth factor Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04010   MAPK signaling pathway hgl04014   Ras signaling pathway hgl04015   Rap1 signaling pathway hgl04151   PI3K-Akt signaling pathway hgl04510   Focal adhesion hgl05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101725085 (Pgf)    04014 Ras signaling pathway     101725085 (Pgf)    04015 Rap1 signaling pathway     101725085 (Pgf)    04151 PI3K-Akt signaling pathway     101725085 (Pgf)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     101725085 (Pgf)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101725085 (Pgf)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     101725085 (Pgf) Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Growth factors (RTK binding)    101725085 (Pgf) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PDGF Motif Other DBs NCBI-GeneID:  101725085 NCBI-ProteinID:  XP_004837243 UniProt:  A0A0P6JD40 LinkDB All DBs Position Un AA seq 170 aa AA seqDB search MLALQLLTCFLQLLAGLALPTVPPKPRALSTGNSSSEVEVVPFQEVWGRSYCRTLEKLVD IVTEYPSEVQYMFSPSCVSLNRCTGCCGDERLQCMPVQTANITMQILKITPGVRPFYVQL TFLQHTLCECRPLQEKTNPERRRPKVRGKRKREKQKPTGCHQCGERAPRR NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgctagccttgcagttgctcacttgcttcctgcagctcctggctgggctggcactgcct actgtgccccccaagccacgcgccctgtctactgggaacagttcgtcagaggtggaagtg gtgcccttccaggaagtatggggccgcagctactgccggacgctggagaagctggtggac attgtgacagagtaccccagcgaggtgcagtacatgttcagcccatcctgcgtctccctg aaccgctgcactggctgctgtggtgacgagcgcctccagtgcatgccggtgcagacagct aacatcaccatgcagatcctgaagatcaccccaggggtccgccccttctacgtgcagctg actttcttgcagcacacactctgcgagtgcagacctctgcaggagaagacaaacccagaa aggaggagacccaaggtcagggggaagaggaagagagagaagcagaaacccacaggctgc caccagtgcggtgaacgtgctccccggaggtaa

DBGET integrated database retrieval system