Heterocephalus glaber (naked mole-rat): 101725935 Help Entry 101725935         CDS       T02812                                  Symbol Pfn2 Name (RefSeq) profilin 2   KO K05759   profilin Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04015   Rap1 signaling pathway hgl04810   Regulation of actin cytoskeleton hgl05014   Amyotrophic lateral sclerosis hgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101725935 (Pfn2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101725935 (Pfn2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101725935 (Pfn2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101725935 (Pfn2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hgl04131]     101725935 (Pfn2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hgl04812]     101725935 (Pfn2)    04147 Exosome [BR:hgl04147]     101725935 (Pfn2) Membrane trafficking [BR:hgl04131]  Others   Actin-binding proteins    Others     101725935 (Pfn2) Cytoskeleton proteins [BR:hgl04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101725935 (Pfn2) Exosome [BR:hgl04147]  Exosomal proteins   Proteins found in most exosomes    101725935 (Pfn2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101725935 NCBI-ProteinID:  XP_004834501 UniProt:  A0AAX6NPZ6 LinkDB All DBs Position Un AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAFELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccaatagaaatagacatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgttcagtgatcagagatagtctatatgtt gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacgtacaat gttgccgtgggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac ggaggcacacttaacaagaaagcatttgaactcgctttatacctgaggaggtctgatgtg taa

DBGET integrated database retrieval system