Heterocephalus glaber (naked mole-rat): 106007543 Help Entry 106007543         CDS       T02812                                  Name (RefSeq) C-C motif chemokine 15-like   KO K05511   C-C motif chemokine 15/23 Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl04060   Cytokine-cytokine receptor interaction hgl04061   Viral protein interaction with cytokine and cytokine receptor hgl04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106007543    04061 Viral protein interaction with cytokine and cytokine receptor     106007543  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     106007543  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hgl04052]     106007543 Cytokines and neuropeptides [BR:hgl04052]  Cytokines   Chemokines    106007543 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  106007543 NCBI-ProteinID:  XP_004870726 UniProt:  A0AAX6QB13 LinkDB All DBs Position Un AA seq 103 aa AA seqDB search MKISMAALSFLILAAALGSQASIIPRFHHPSDCCFSYTSRRIRCTLMEDYFETSSGCPKP GVIFTTKKGQRVCANPSDSRVQDCMIYLTLTLVPKDLGTLNLR NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaagatctccatggctgccctctccttcctcatccttgccgctgcccttggatcccag gccagcatcatacctcgctttcaccatcctagtgactgctgcttctcctacacttcacga aggatccggtgtacactcatggaagattattttgagacaagcagtgggtgccccaagcca ggtgtcatcttcaccaccaaaaaaggacaacgtgtctgtgccaaccccagcgattcgaga gttcaggattgcatgatatacctaaccctgaccttggtgcccaaggacctgggaacgcta aatcttcgctag

DBGET integrated database retrieval system