Hankyongella ginsenosidimutans: E6W36_05795 Help Entry E6W36_05795       CDS       T06455                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hgn  Hankyongella ginsenosidimutans Pathway hgn01100   Metabolic pathways hgn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hgn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E6W36_05795    00074 Mycolic acid biosynthesis     E6W36_05795   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E6W36_05795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 Motif Other DBs NCBI-ProteinID:  QCI79245 UniProt:  A0A4D7C694 LinkDB All DBs Position complement(1074999..1075238) Genome browser AA seq 79 aa AA seqDB search MSDVAERVKKIVVEHLGVDAGKVTESASFIDDLGADSLDTVELVMAFEEEFSIEIPDDAA EKILTVKDAIDFIQANASA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgctgaacgcgtgaagaagattgtcgttgaacatttgggcgtcgacgcc ggcaaggtgactgagtccgccagcttcattgacgatctcggcgctgacagcctggatact gtcgaactggtcatggcgttcgaagaggaattcagcattgagatcccggacgacgccgca gagaagattctgacggtgaaggatgccatcgacttcatacaagccaacgcttccgcgtaa

DBGET integrated database retrieval system