Hankyongella ginsenosidimutans: E6W36_14230 Help Entry E6W36_14230       CDS       T06455                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism hgn  Hankyongella ginsenosidimutans Brite KEGG Orthology (KO) [BR:hgn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hgn03032]     E6W36_14230    03036 Chromosome and associated proteins [BR:hgn03036]     E6W36_14230    03400 DNA repair and recombination proteins [BR:hgn03400]     E6W36_14230 DNA replication proteins [BR:hgn03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E6W36_14230 Chromosome and associated proteins [BR:hgn03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E6W36_14230 DNA repair and recombination proteins [BR:hgn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E6W36_14230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 Motif Other DBs NCBI-ProteinID:  QCI80244 UniProt:  A0A4D7C3C6 LinkDB All DBs Position 2556733..2557005 Genome browser AA seq 90 aa AA seqDB search MNKQDLIGEVADAAGLSKTDAGKAVDAVLDGITHALKKGDEVRLVGFGTFLVSRRAASTG RNPRTGEPIEIKASAQPKFKPGKGLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaacaagacctgatcggcgaagtcgctgacgccgccggcctgagcaagacggac gccggcaaggccgtcgacgcagtgctcgacggcatcacgcatgcgctcaagaagggcgac gaagtccgccttgtcggcttcggcacgttcctcgtgagccgtcgcgccgccagcaccggc cgcaatccgcgcaccggcgagccgatcgaaatcaaggcttcggcccagcccaagttcaaa ccgggcaagggtctgaaggacgcggtcaactaa

DBGET integrated database retrieval system