Hylemonella gracilis: DW355_11310 Help Entry DW355_11310       CDS       T09883                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hgr  Hylemonella gracilis Pathway hgr01100   Metabolic pathways hgr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hgr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DW355_11310    00074 Mycolic acid biosynthesis     DW355_11310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DW355_11310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding MerR_2 AHD ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QBK05261 UniProt:  A0A4P6UNS6 LinkDB All DBs Position complement(2387687..2387941) Genome browser AA seq 84 aa AA seqDB search MTKDDILQKIVSILHDTFDIEVARITPEARLYDDLDIDSIDAIDLIVQLKPLLGKRLQPE AFKSVRTVQDVVDAIHALAQEPAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccaaagacgacatcctgcagaaaatcgtgtccatcctgcacgacaccttcgacatc gaggtggcgcgcatcacccccgaggcgcggctctacgacgacctggacatcgacagcatc gacgccatcgacctgatcgtgcagctcaagccgctgctgggcaagcgcctgcagcccgaa gccttcaagtccgtacgcaccgtccaggacgtggtggacgccatccacgccctggcgcag gaacctgcggcctga

DBGET integrated database retrieval system