Hylemonella gracilis: DW355_13815 Help Entry DW355_13815       CDS       T09883                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism hgr  Hylemonella gracilis Brite KEGG Orthology (KO) [BR:hgr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hgr03110]     DW355_13815 Chaperones and folding catalysts [BR:hgr03110]  Protein folding catalysts   Protein disulfide isomerase    DW355_13815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  QBK06606 UniProt:  A0A4P6UP60 LinkDB All DBs Position complement(2953761..2954003) Genome browser AA seq 80 aa AA seqDB search MTLKITVYSKSACQQCDTAKMLLKSRSLPFEEIRIDDEAERLAFYEKCGPSVRQMPQIFI NDQRVGGVAGLQAALAQLRG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaccctgaaaattaccgtctattccaaatccgcctgccagcaatgcgacacggccaag atgctgctcaagagccgctcactgccgttcgaggaaatccgcatcgatgacgaggccgag cgcctggcgttctatgaaaaatgcggcccgtccgtgcgccagatgccgcagatcttcatc aacgaccagcgcgtgggtggcgtggcgggtctgcaggcggcgctggcgcagttgcgaggc tga

DBGET integrated database retrieval system