Halorhodospira halophila: Hhal_1183 Help Entry Hhal_1183         CDS       T00462                                  Name (GenBank) conserved hypothetical protein   KO K09892   cell division protein ZapB Organism hha  Halorhodospira halophila Brite KEGG Orthology (KO) [BR:hha00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hha03036]     Hhal_1183 Chromosome and associated proteins [BR:hha03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Hhal_1183 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Spectrin ING TSC22 NRBF2 MPS2 YabA DUF6262 ADIP DUF3450 DUF2205 ATG14 V_ATPase_I Motif Other DBs NCBI-ProteinID:  ABM61958 UniProt:  A1WW96 LinkDB All DBs Position complement(1287639..1287851) Genome browser AA seq 70 aa AA seqDB search MSDYSVEELVRLEQRIEQLLRQHERLREENRLLREAQEQLQADRAALQEKNELARSQIES MISRLKAMEQ NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgtctgattactcggtcgaagagctggtgcgtctggagcagcgcatcgagcagctgctg cgccagcacgagcgcctgcgcgaggaaaaccgcctgcttcgcgaggcgcaggagcagctc caggcggatcgggcggcgcttcaggaaaagaacgaactcgcccgttcccagatcgagtcg atgatcagccggctcaaggcgatggagcagtag

DBGET integrated database retrieval system