Halorhodospira halophila: Hhal_1232 Help Entry Hhal_1232         CDS       T00462                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hha  Halorhodospira halophila Pathway hha01100   Metabolic pathways hha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Hhal_1232    00074 Mycolic acid biosynthesis     Hhal_1232   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Hhal_1232 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 DUF5783 DUF1896 Motif Other DBs NCBI-ProteinID:  ABM62007 UniProt:  A1WWE5 LinkDB All DBs Position complement(1339149..1339388) Genome browser AA seq 79 aa AA seqDB search MSSIEDRVKKIVVEQLGVKEEEVTGEASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAVDYIKKHLEG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagcatcgaagatcgcgtcaagaaaatcgtcgtcgagcaactgggggtcaaagag gaagaggtcactggtgaggcctcgttcgtggacgaccttggcgccgactcgctggacacc gtcgagctcgtgatggcgctcgaggaagagttcgagtgcgagatccccgacgaggaagcc gaaaagatcacaacggtccagcaggccgtggactacatcaagaagcacctcgaggggtaa

DBGET integrated database retrieval system