Halomonas halophila: QWG60_03685 Help Entry QWG60_03685       CDS       T09170                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism hhao  Halomonas halophila Brite KEGG Orthology (KO) [BR:hhao00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hhao03036]     QWG60_03685 (ftsB) Chromosome and associated proteins [BR:hhao03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     QWG60_03685 (ftsB) SSDB OrthologParalogGFIT Motif Pfam:  DivIC Rod_CreS bZIP_1 CC_Bre1 NRBF2 HALZ bZIP_2 ZapB TolA_bind_tri Ax_dynein_light CENP-H ODF2_C SR_plectin_7 VPA1267 IPGA1_CC PRR11_2nd ADIP Sas-6_C_CC Asd-4 CEP152_CC1 Seadorna_VP6 DUF2730 Motif Other DBs NCBI-ProteinID:  WJY08020 LinkDB All DBs Position 810845..811141 Genome browser AA seq 98 aa AA seqDB search MLKWLAIVLIALQALLQYRLWLGEGGLRELAEVRQRVDRLEAENAPLRARNERLAAEVVD LKNGLDAIEERARSDIGMVRRDEQFFWVPDAEPAGEAP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgctcaagtggctggccatcgtgctcatcgccctgcaggcgctgttgcagtatcgcctg tggctcggcgagggcggactgcgcgagctggccgaggtgcgccagcgagtggaccgcctg gaggccgagaatgcgccgctgcgggcgcgcaacgagcgcctcgccgccgaggtggtcgat ctcaagaacggcctcgatgccatcgaggagcgcgcgcgcagcgatatcggcatggtgcgc cgcgacgagcagttcttctgggtgcccgacgccgagccggccggggaggcgccgtga

DBGET integrated database retrieval system