Halomonas halophila: QWG60_10690 Help Entry QWG60_10690       CDS       T09170                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hhao  Halomonas halophila Pathway hhao01100   Metabolic pathways hhao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hhao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QWG60_10690 (acpP)    00074 Mycolic acid biosynthesis     QWG60_10690 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QWG60_10690 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  WJY06175 LinkDB All DBs Position complement(2304429..2304662) Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAVDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtgaagaaggttgtggccgagcgcctgaacgtcaaggaa gaggacatccagaactcttcttctttcaccgaggacctcggcgcggattccctggatacc gtcgagctggtgatggcgctcgaagaggaattcgacaccgagattcccgacgaggaagcc gagaagatcaccaccgttcaggaagccgtcgactacgtcaacgcccaccagtaa

DBGET integrated database retrieval system