Halomonas halophila: QWG60_16645 Help Entry QWG60_16645       CDS       T09170                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism hhao  Halomonas halophila Pathway hhao00190   Oxidative phosphorylation hhao01100   Metabolic pathways Module hhao_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:hhao00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     QWG60_16645 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:hhao00194]     QWG60_16645 (atpE) Photosynthesis proteins [BR:hhao00194]  Photosystem and electron transport system   F-type ATPase [OT]    QWG60_16645 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C FtsX Motif Other DBs NCBI-ProteinID:  WJY07287 LinkDB All DBs Position complement(3531007..3531234) Genome browser AA seq 75 aa AA seqDB search MELVYIAASLMIGLGALGTGIGFALLGGKLLETTARQPELGNQLQTKTFLMAGLLDAVPM IGVGIAMYLIFVVAG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggaactcgtctacatcgccgcttccctcatgatcggcctgggcgctctgggtactggc atcggcttcgctctgctgggcggcaagctgctcgagaccaccgctcgccagccggagctg ggcaaccagctgcagaccaagaccttcctgatggccggcctgctggacgccgtgccgatg atcggcgttggtatcgcgatgtacctgatcttcgtcgtcgccggctaa

DBGET integrated database retrieval system