Harpia harpyja (harpy eagle): 128135462 Help Entry 128135462         CDS       T10541                                  Name (RefSeq) histone H2A.J   KO K11251   histone H2A Organism hhar  Harpia harpyja (harpy eagle) Pathway hhar03082   ATP-dependent chromatin remodeling hhar04217   Necroptosis Brite KEGG Orthology (KO) [BR:hhar00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     128135462  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     128135462  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hhar03036]     128135462   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhar04147]     128135462 Chromosome and associated proteins [BR:hhar03036]  Eukaryotic type   Nucleosome assembly factors    Histones     128135462 Exosome [BR:hhar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128135462 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  128135462 NCBI-ProteinID:  XP_052630397 LinkDB All DBs Position 23:1202476..1203508 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgcgggaagcagggaggcaaagtccgagctaaagctaagtcacgctcgtcg cgggccgggctgcagttccccgtgggccgagtccaccggctccttcggaaaggcaactac gcggagcgggtgggggctggagcgcccgtgtacatggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccccggcacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaag gtgaccatcgcgcagggcggggtgctgcccaacatccaggccgtgctgctgcccaagaag accgagagccacaaggctaaaagcaaataa

DBGET integrated database retrieval system