Harpia harpyja (harpy eagle): 128136332 Help Entry 128136332         CDS       T10541                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism hhar  Harpia harpyja (harpy eagle) Pathway hhar04081   Hormone signaling hhar04144   Endocytosis hhar04150   mTOR signaling pathway hhar04270   Vascular smooth muscle contraction hhar04310   Wnt signaling pathway hhar04350   TGF-beta signaling pathway hhar04510   Focal adhesion hhar04517   IgSF CAM signaling hhar04519   Cadherin signaling hhar04520   Adherens junction hhar04530   Tight junction hhar04621   NOD-like receptor signaling pathway hhar04625   C-type lectin receptor signaling pathway hhar04810   Regulation of actin cytoskeleton hhar05100   Bacterial invasion of epithelial cells hhar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hhar00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     128136332 (RHOA)    04350 TGF-beta signaling pathway     128136332 (RHOA)    04150 mTOR signaling pathway     128136332 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     128136332 (RHOA)    04517 IgSF CAM signaling     128136332 (RHOA)    04519 Cadherin signaling     128136332 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128136332 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     128136332 (RHOA)    04520 Adherens junction     128136332 (RHOA)    04530 Tight junction     128136332 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128136332 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     128136332 (RHOA)    04625 C-type lectin receptor signaling pathway     128136332 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     128136332 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128136332 (RHOA)    05100 Bacterial invasion of epithelial cells     128136332 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hhar04131]     128136332 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhar04147]     128136332 (RHOA)    04031 GTP-binding proteins [BR:hhar04031]     128136332 (RHOA) Membrane trafficking [BR:hhar04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     128136332 (RHOA) Exosome [BR:hhar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128136332 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    128136332 (RHOA)   Exosomal proteins of colorectal cancer cells    128136332 (RHOA)   Exosomal proteins of bladder cancer cells    128136332 (RHOA) GTP-binding proteins [BR:hhar04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     128136332 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  128136332 NCBI-ProteinID:  XP_052631613 LinkDB All DBs Position Z:8445228..8471621 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aattatgtagcagatatcgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaagaagactatgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc ccagaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaagaaggaagagatatggcaaaccgcattggtgcatttgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttgtcttataa

DBGET integrated database retrieval system