Harpia harpyja (harpy eagle): 128140444 Help Entry 128140444         CDS       T10541                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism hhar  Harpia harpyja (harpy eagle) Pathway hhar04010   MAPK signaling pathway hhar04020   Calcium signaling pathway hhar04114   Oocyte meiosis hhar04218   Cellular senescence hhar04310   Wnt signaling pathway hhar04370   VEGF signaling pathway hhar04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:hhar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128140444 (PPP3R1)    04310 Wnt signaling pathway     128140444 (PPP3R1)    04370 VEGF signaling pathway     128140444 (PPP3R1)    04020 Calcium signaling pathway     128140444 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     128140444 (PPP3R1)    04218 Cellular senescence     128140444 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128140444 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hhar01009]     128140444 (PPP3R1) Protein phosphatases and associated proteins [BR:hhar01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      128140444 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  128140444 NCBI-ProteinID:  XP_052640119 LinkDB All DBs Position 4:57266390..57307198 Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagctaccctttggaaatgtgctcgcactttgatgcggatgagata aaacgactaggaaagagatttaagaagcttgatttggacaactctggttctttgagcgtg gaagagttcatgtctttacctgaactgcaacagaacccactagtacagcgagtaatagat atatttgacacagatggaaatggagaagtggacttcaaagaatttatagaaggagtctcc cagttcagtgtcaaaggagataaggaacagaaattgaggtttgcttttcgcatatatgat atggacaaagatggttatatctcaaatggagagctcttccaggtgctcaagatgatggtt gggaacaatctcaaagacactcagttacagcaaattgtagataaaaccataattaatgca gataaggatggtgatggaagaatatcctttgaagaattctgtgctgttgtaggaggctta gatatccacaaaaagatggttgtagacgtgtga

DBGET integrated database retrieval system