Harpia harpyja (harpy eagle): 128145088 Help Entry 128145088         CDS       T10541                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism hhar  Harpia harpyja (harpy eagle) Pathway hhar04814   Motor proteins hhar05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hhar00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     128145088 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128145088 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hhar03037]     128145088 (DYNLT3)    04812 Cytoskeleton proteins [BR:hhar04812]     128145088 (DYNLT3) Cilium and associated proteins [BR:hhar03037]  Motile cilia and associated proteins   Dynein arm    128145088 (DYNLT3) Cytoskeleton proteins [BR:hhar04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      128145088 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 RE_SacI Motif Other DBs NCBI-GeneID:  128145088 NCBI-ProteinID:  XP_052650670 LinkDB All DBs Position 8:complement(8192165..8199943) Genome browser AA seq 116 aa AA seqDB search MEEFHPHNDEMIFNADEAHNIVKECIESVLGKADYNHNKVNQWTAAIVEQSLTHLVKLGK TYKYIVTCAVMQKSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtttcacccccataacgacgagatgatcttcaatgctgatgaggcccacaac atagttaaggagtgcatagaaagtgttttaggcaaggcagattataatcacaacaaagtc aaccagtggactgctgctatagtagaacagtcgctgacacatctggtaaaactcggaaaa acatacaagtacattgtaacctgtgcggtgatgcagaagagtggagctggtcttcacaca gcaagctcatgtttctgggatactacaactgatggaacctgcacagtgagatgggaaaac cgaacaatgaactgcattgtcaatgtgtttgctgttgctattatcctgtag

DBGET integrated database retrieval system