Harpia harpyja (harpy eagle): 128146606 Help Entry 128146606         CDS       T10541                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism hhar  Harpia harpyja (harpy eagle) Brite KEGG Orthology (KO) [BR:hhar00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hhar03019]     128146606    03029 Mitochondrial biogenesis [BR:hhar03029]     128146606 Messenger RNA biogenesis [BR:hhar03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      128146606 Mitochondrial biogenesis [BR:hhar03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     128146606 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  128146606 NCBI-ProteinID:  XP_052654088 LinkDB All DBs Position 9:21659291..21660178 Genome browser AA seq 63 aa AA seqDB search MDPQDCSCAAGDSCSCAGSCKCKNCRCRSCRKSCCSCCPASCSNCAKGCVCKEPASSKCS CCH NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggacccccaggactgctcgtgtgccgccggtgactcctgctcctgcgccgggtcctgc aagtgcaagaactgccgctgccggagctgccgcaagagctgctgctcctgctgccctgca agctgcagcaactgtgccaagggctgcgtgtgcaaggagccggctagcagcaagtgcagc tgctgccactga

DBGET integrated database retrieval system