Harpia harpyja (harpy eagle): 128152831 Help Entry 128152831         CDS       T10541                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism hhar  Harpia harpyja (harpy eagle) Pathway hhar03030   DNA replication hhar03410   Base excision repair hhar03420   Nucleotide excision repair hhar03430   Mismatch repair hhar03440   Homologous recombination Brite KEGG Orthology (KO) [BR:hhar00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     128152831 (POLD4)    03410 Base excision repair     128152831 (POLD4)    03420 Nucleotide excision repair     128152831 (POLD4)    03430 Mismatch repair     128152831 (POLD4)    03440 Homologous recombination     128152831 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hhar03032]     128152831 (POLD4)    03400 DNA repair and recombination proteins [BR:hhar03400]     128152831 (POLD4) DNA replication proteins [BR:hhar03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     128152831 (POLD4) DNA repair and recombination proteins [BR:hhar03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       128152831 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      128152831 (POLD4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  128152831 NCBI-ProteinID:  XP_052667431 LinkDB All DBs Position 16:complement(31836386..31840347) Genome browser AA seq 115 aa AA seqDB search MEQPRRITDSFPRRRRRPGRIPGGVKGRDCPRARPRAPPPSEEPPPSPPDQALLEMLRRF DLAWEYGPCTGITRLQRWERAQALGLSPPGPVRDALLEHWDNPDVIYSLWHEYGL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggagcagccccggcgcatcaccgactccttcccgcggcggcggagacgaccgggccga atcccgggcggggtgaagggcagggactgtccccgggcccggccccgtgcccccccgccc tccgaggagcccccgccgtcccccccggaccaagctctcctggagatgctcaggcgcttc gacctcgcctgggagtacggaccctgcaccggtatcacccgcctgcagcggtgggagcgg gcgcaggcgctggggctgagccccccgggccccgtccgtgacgccctcctggaacactgg gacaaccctgacgtcatctacagcctctggcacgagtacgggctctga

DBGET integrated database retrieval system