Harpia harpyja (harpy eagle): 128153022 Help Entry 128153022         CDS       T10541                                  Name (RefSeq) C-X-C motif chemokine 5-like   KO K10030   interleukin 8 Organism hhar  Harpia harpyja (harpy eagle) Pathway hhar04060   Cytokine-cytokine receptor interaction hhar04218   Cellular senescence hhar04620   Toll-like receptor signaling pathway hhar04621   NOD-like receptor signaling pathway hhar04622   RIG-I-like receptor signaling pathway hhar05132   Salmonella infection hhar05164   Influenza A Brite KEGG Orthology (KO) [BR:hhar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128153022  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     128153022  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     128153022    04621 NOD-like receptor signaling pathway     128153022    04622 RIG-I-like receptor signaling pathway     128153022  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     128153022   09171 Infectious disease: bacterial    05132 Salmonella infection     128153022  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhar04052]     128153022    00536 Glycosaminoglycan binding proteins [BR:hhar00536]     128153022 Cytokines and neuropeptides [BR:hhar04052]  Cytokines   Chemokines    128153022 Glycosaminoglycan binding proteins [BR:hhar00536]  Heparan sulfate / Heparin   Chemokines    128153022 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  128153022 NCBI-ProteinID:  XP_052667808 LinkDB All DBs Position 2:complement(1392781..1398112) Genome browser AA seq 97 aa AA seqDB search MDSKTLISLLILSFMGNLPEMMLAAELRCHCIQTVTGLMLPKRLANVEIIPKGPHCNAVE IIATLKNSQQICLDPQAKWVKMIINRILHSASKKRRQ NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggatagcaagactctaatctccctcctgattctctcttttatgggcaaccttcctgag atgatgctggcagcggagctgcggtgtcactgcatccagaccgtcacaggattaatgttg ccaaagcgcctggccaacgtagaaatcattcctaagggcccacactgcaacgctgtggaa atcatagcaacgctgaagaacagccagcaaatctgtttagatccccaggccaaatgggtg aagatgataattaacaggattctacacagtgcatccaagaaacggcgtcagtga

DBGET integrated database retrieval system