Harpia harpyja (harpy eagle): 128154782 Help Entry 128154782         CDS       T10541                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism hhar  Harpia harpyja (harpy eagle) Pathway hhar04010   MAPK signaling pathway hhar04012   ErbB signaling pathway hhar04068   FoxO signaling pathway hhar04137   Mitophagy - animal hhar04140   Autophagy - animal hhar04150   mTOR signaling pathway hhar04210   Apoptosis hhar04218   Cellular senescence hhar04370   VEGF signaling pathway hhar04371   Apelin signaling pathway hhar04540   Gap junction hhar04625   C-type lectin receptor signaling pathway hhar04810   Regulation of actin cytoskeleton hhar04910   Insulin signaling pathway hhar04912   GnRH signaling pathway hhar04916   Melanogenesis Brite KEGG Orthology (KO) [BR:hhar00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128154782 (NRAS)    04012 ErbB signaling pathway     128154782 (NRAS)    04370 VEGF signaling pathway     128154782 (NRAS)    04371 Apelin signaling pathway     128154782 (NRAS)    04068 FoxO signaling pathway     128154782 (NRAS)    04150 mTOR signaling pathway     128154782 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128154782 (NRAS)    04137 Mitophagy - animal     128154782 (NRAS)   09143 Cell growth and death    04210 Apoptosis     128154782 (NRAS)    04218 Cellular senescence     128154782 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     128154782 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128154782 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128154782 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     128154782 (NRAS)    04912 GnRH signaling pathway     128154782 (NRAS)    04916 Melanogenesis     128154782 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hhar04131]     128154782 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhar04147]     128154782 (NRAS)    04031 GTP-binding proteins [BR:hhar04031]     128154782 (NRAS) Membrane trafficking [BR:hhar04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     128154782 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     128154782 (NRAS) Exosome [BR:hhar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128154782 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    128154782 (NRAS)   Exosomal proteins of breast cancer cells    128154782 (NRAS)   Exosomal proteins of colorectal cancer cells    128154782 (NRAS) GTP-binding proteins [BR:hhar04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128154782 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  128154782 NCBI-ProteinID:  XP_052671808 LinkDB All DBs Position 19:complement(24203915..24210877) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagccggcggcgtcggcaagagcgcgctgacc atccagctcatccagaaccactttgtggacgagtacgaccccaccatcgaggattcctat agaaagcaggttgttatcgatggagagacgtgtttgttagacattctggacactgcggga caggaagagtatagtgccatgcgtgatcagtacatgagaactggggaaggattcctctgt gtttttgccattaacaacagtaaatcgtttgctgatattaacctttacagagaacagatc aagagagtgaaagattcagatgatgtgccgatggtgctagttgggaacaagtgtgacttg cccacgagaacagtagacacaaaacaggctcaagaattagcaaaaagctatggaatcccc ttcatagagacatctgctaaaacgagacagggtgtggaagatgctttttacacactggtg agagagatccggcagtatcggatgaaaaaactcaacagcaatgaagatgggaatcaaggc tgcatgggattgtcttgcattgtgatgtga

DBGET integrated database retrieval system