Harpia harpyja (harpy eagle): 128154782 Help Entry 128154782         CDS       T10541                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism hhar  Harpia harpyja (harpy eagle) Pathway hhar04010   MAPK signaling pathway hhar04012   ErbB signaling pathway hhar04068   FoxO signaling pathway hhar04137   Mitophagy - animal hhar04140   Autophagy - animal hhar04150   mTOR signaling pathway hhar04210   Apoptosis hhar04218   Cellular senescence hhar04370   VEGF signaling pathway hhar04371   Apelin signaling pathway hhar04540   Gap junction hhar04625   C-type lectin receptor signaling pathway hhar04810   Regulation of actin cytoskeleton hhar04910   Insulin signaling pathway hhar04912   GnRH signaling pathway hhar04916   Melanogenesis Brite Membrane trafficking [BR:hhar04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     128154782 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     128154782 (NRAS) Exosome [BR:hhar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128154782 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    128154782 (NRAS)   Exosomal proteins of breast cancer cells    128154782 (NRAS)   Exosomal proteins of colorectal cancer cells    128154782 (NRAS) GTP-binding proteins [BR:hhar04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128154782 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  128154782 NCBI-ProteinID:  XP_052671808 LinkDB All DBs Position 19:complement(24203915..24210877) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggagccggcggcgtcggcaagagcgcgctgacc atccagctcatccagaaccactttgtggacgagtacgaccccaccatcgaggattcctat agaaagcaggttgttatcgatggagagacgtgtttgttagacattctggacactgcggga caggaagagtatagtgccatgcgtgatcagtacatgagaactggggaaggattcctctgt gtttttgccattaacaacagtaaatcgtttgctgatattaacctttacagagaacagatc aagagagtgaaagattcagatgatgtgccgatggtgctagttgggaacaagtgtgacttg cccacgagaacagtagacacaaaacaggctcaagaattagcaaaaagctatggaatcccc ttcatagagacatctgctaaaacgagacagggtgtggaagatgctttttacacactggtg agagagatccggcagtatcggatgaaaaaactcaacagcaatgaagatgggaatcaaggc tgcatgggattgtcttgcattgtgatgtga

DBGET integrated database retrieval system