Halobacterium hubeiense: Hhub_3344 Help Entry Hhub_3344         CDS       T04202                                  Symbol rps31e Name (GenBank) 30S ribosomal protein S31e   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hhb  Halobacterium hubeiense Pathway hhb03010   Ribosome Brite KEGG Orthology (KO) [BR:hhb00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Hhub_3344 (rps31e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Hhub_3344 (rps31e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hhb03011]     Hhub_3344 (rps31e)    04121 Ubiquitin system [BR:hhb04121]     Hhub_3344 (rps31e)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhb04147]     Hhub_3344 (rps31e) Ribosome [BR:hhb03011]  Ribosomal proteins   Eukaryotes    Small subunit     Hhub_3344 (rps31e)   Archaea     Hhub_3344 (rps31e) Ubiquitin system [BR:hhb04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Hhub_3344 (rps31e) Exosome [BR:hhb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Hhub_3344 (rps31e)   Exosomal proteins of colorectal cancer cells    Hhub_3344 (rps31e) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 DZR_2 Ribosomal_L37e Zn_ribbon_RPB9 Zn_Ribbon_TF Rcat_RNF216 Zn_ribbon_19 zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  CQH61005 UniProt:  A0A0U5H4S7 LinkDB All DBs Position I:complement(2120313..2120447) Genome browser AA seq 44 aa AA seqDB search MPRSDYYNDDGTTDKEMCPRCGDTFLADHGDRQYCGKCSYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgccccggagcgactactacaacgacgacggcacgacggataaggagatgtgcccgcgc tgcggggacacgttcctcgcggaccacggcgaccggcagtactgcgggaagtgcagctac accgagtgggagtag

DBGET integrated database retrieval system