Ectothiorhodospira haloalkaliphila: M911_09005 Help Entry M911_09005        CDS       T03059                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hhc  Ectothiorhodospira haloalkaliphila Pathway hhc01100   Metabolic pathways hhc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hhc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M911_09005    00074 Mycolic acid biosynthesis     M911_09005   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M911_09005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 HLH DUF1896 Motif Other DBs NCBI-ProteinID:  AHK79258 UniProt:  W8KJC1 LinkDB All DBs Position complement(1861430..1861672) Genome browser AA seq 80 aa AA seqDB search MSNIEERVKKIVVEQLGVKEEDVTNSASFVDDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQQAIDYINEHLPNA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcaatatcgaagaacgcgtcaagaaaatcgtcgttgagcaactcggcgtcaaggaa gaagacgtcaccaacagtgcctctttcgtggacgatctcggcgcggattcactggacacc gttgaactggtgatggcgctggaagaggaattcgaaaccgaaattcctgacgagcaggcc gagaagatcaccactgttcagcaggccatcgactacatcaatgagcacctgccgaacgcc tga

DBGET integrated database retrieval system