Halobacillus halophilus: HBHAL_2853
Help
Entry
HBHAL_2853 CDS
T02031
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
hhd
Halobacillus halophilus
Pathway
hhd00770
Pantothenate and CoA biosynthesis
hhd01100
Metabolic pathways
hhd01240
Biosynthesis of cofactors
Module
hhd_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
hhd00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
HBHAL_2853 (coaD)
Enzymes [BR:
hhd01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
HBHAL_2853 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
RGS
CoV_NSP15_M
Pantoate_ligase
Herpes_UL92
Motif
Other DBs
NCBI-ProteinID:
CCG45201
UniProt:
I0JM31
LinkDB
All DBs
Position
1850343..1850822
Genome browser
AA seq
159 aa
AA seq
DB search
MPTLAICPGSFDPVTYGHLDIIQRGAKVFDHVIVAVFNNQSKAPLFDVEERCGLLREVTK
NLDNVSVDSCSGLLMDYAEEKNAQAIIRGLRAVSDFEYEMQITSMNRKLNADIETFFMMT
NNQYSFLSSSIVKEVAKYRASISDLVPPPVEKALFTKFE
NT seq
480 nt
NT seq
+upstream
nt +downstream
nt
atgcccacattagctatttgtccaggcagttttgacccggttacatacggtcatttagat
attattcagcgaggtgcaaaagtgttcgaccacgttattgttgctgtgtttaataatcag
agtaaagcacctctgtttgacgtggaggaacgctgcgggctccttagggaagtaaccaaa
aacctggacaacgtttctgttgattcctgcagtggtttattaatggattatgcagaagaa
aagaatgcccaggcgatcatccgtggattgcgtgccgtcagcgatttcgaatatgaaatg
cagattacatcgatgaaccgcaaattaaacgctgatattgagacgttctttatgatgaca
aataaccaatattcttttttaagttccagcatcgtaaaagaggtagccaaatacagagcg
agtatttcagatttagtacctcctcctgtagaaaaagctttatttactaagtttgaataa
DBGET
integrated database retrieval system