Halobacillus halophilus: HBHAL_3596 Help Entry HBHAL_3596        CDS       T02031                                  Name (GenBank) hypothetical protein   KO K06371   developmental checkpoint coupling sporulation initiation to replication initiation Organism hhd  Halobacillus halophilus Brite KEGG Orthology (KO) [BR:hhd00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     HBHAL_3596 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sda SMN_G2-BD DUF7017 Motif Other DBs NCBI-ProteinID:  CCG45942 UniProt:  I0JP72 LinkDB All DBs Position 2556701..2556862 Genome browser AA seq 53 aa AA seqDB search MSDRGIKQLSDSLLIQSYHKAIELNLSEDFILQMREELIARSINMDNLAIQVG NT seq 162 nt NT seq  +upstreamnt  +downstreamnt atgagtgacagaggtataaaacaattatctgattccctgttaatacaatcttaccacaaa gcaattgaactgaatctctcggaagacttcattcttcaaatgagagaagaactcatagcc agatcgatcaatatggataatttagctatccaggtcggttaa

DBGET integrated database retrieval system