Helicobacter hepaticus: HH_0728 Help Entry HH_0728           CDS       T00133                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hhe  Helicobacter hepaticus Pathway hhe01100   Metabolic pathways hhe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hhe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HH_0728    00074 Mycolic acid biosynthesis     HH_0728   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HH_0728 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AAP77325 UniProt:  Q7VI80 LinkDB All DBs Position complement(709006..709236) Genome browser AA seq 76 aa AA seqDB search MDTFESVKAVVVEQLSVDANEVKPESRFIEDLNADSLDVVELVMALEEKFSIEIPDEEAE KIKTVKDVVAYIEANK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggatacatttgaaagtgtaaaggctgtagttgttgaacaattaagtgttgatgcaaat gaagtaaaacccgaatctcgttttattgaggatttgaatgcagattctcttgatgttgta gagcttgttatggctcttgaagagaaattctctattgagattccagatgaagaagcagaa aaaatcaaaacagtcaaagatgttgttgcttatattgaagctaacaaataa

DBGET integrated database retrieval system