Herbaspirillum huttiense: E2K99_01745 Help Entry E2K99_01745       CDS       T05937                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism hhf  Herbaspirillum huttiense Brite KEGG Orthology (KO) [BR:hhf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hhf03036]     E2K99_01745 (ftsL) Chromosome and associated proteins [BR:hhf03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     E2K99_01745 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  QBP73810 LinkDB All DBs Position 385526..385798 Genome browser AA seq 90 aa AA seqDB search MTGRLCILLTIMLVGCALSVVSAQYKARSLFIELERAQSAARQLDVDWAQLQLDQSTLGK NARIEELARRDLGMVPVSSARTQYLTVGAP NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaccgggcgtctgtgcatcctgctgaccatcatgctggtgggttgcgcgctgtcggtc gtgagcgcccagtacaaggcccgcagcctgttcatcgagctggaacgcgcccagagcgcg gcccgccagctcgacgtcgactgggcgcagctgcagctggaccaatcgacgctgggcaag aacgcccgcatcgaggaactggcgcgccgtgacctgggcatggttccggtctcctccgcc cgtacccaatacctgaccgtgggggcaccatga

DBGET integrated database retrieval system