Herbaspirillum huttiense: E2K99_13730 Help Entry E2K99_13730       CDS       T05937                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism hhf  Herbaspirillum huttiense Brite KEGG Orthology (KO) [BR:hhf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:hhf03032]     E2K99_13730    03036 Chromosome and associated proteins [BR:hhf03036]     E2K99_13730    03400 DNA repair and recombination proteins [BR:hhf03400]     E2K99_13730 DNA replication proteins [BR:hhf03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E2K99_13730 Chromosome and associated proteins [BR:hhf03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E2K99_13730 DNA repair and recombination proteins [BR:hhf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E2K99_13730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-HIG Motif Other DBs NCBI-ProteinID:  QBP76001 LinkDB All DBs Position complement(3043994..3044266) Genome browser AA seq 90 aa AA seqDB search MNKGELIEHIAGEADISKAAAGRAVDAFIGAVKTTLKKNGTVTLVGFGTFAVGKRAARTG RNPQTGAALKIKASKVPKFKAGKALKDAIK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaaggcgaactgattgagcacattgccggcgaggcagacatctccaaggcagca gcaggacgagcagtagacgcattcattggtgcagtgaagaccacgctgaagaagaacggc acggtcaccctggtgggttttggcacttttgcggtgggcaagcgtgcggcgcgtacgggc cgcaatcctcagacgggcgccgcgctgaaaatcaaggcatcgaaggttcctaaatttaaa gctggcaaagctttaaaagatgctataaaataa

DBGET integrated database retrieval system