Herbaspirillum huttiense: E2K99_18840 Help Entry E2K99_18840       CDS       T05937                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hhf  Herbaspirillum huttiense Pathway hhf01100   Metabolic pathways hhf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hhf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E2K99_18840    00074 Mycolic acid biosynthesis     E2K99_18840   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E2K99_18840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QBP76927 LinkDB All DBs Position 4217808..4218071 Genome browser AA seq 87 aa AA seqDB search MHDLEQDIKQLIIEALDLEDLTPGDIDSAAPLFGDGLGLDSIDALELGMSLQKRYGIKLS ANSEETRKHFASVQALAALVASHQATA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcacgatctggaacaagacatcaagcaactcatcatcgaggccctcgacctggaggac ctcactcccggcgatatcgacagcgccgcgcccttgttcggcgatggcctgggactggat tcgatcgacgcgctggaactgggcatgagcctgcagaaacgctacggcatcaagctctcg gccaactccgaagaaacccgcaagcacttcgcctcggttcaggcgctggctgcgctggta gccagccaccaggccaccgcctga

DBGET integrated database retrieval system