Halomonas hydrothermalis: CLM76_16685 Help Entry CLM76_16685       CDS       T05117                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hhh  Halomonas hydrothermalis Pathway hhh01100   Metabolic pathways hhh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hhh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CLM76_16685    00074 Mycolic acid biosynthesis     CLM76_16685   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CLM76_16685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  ATH79132 LinkDB All DBs Position complement(3564683..3564916) Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgttaaaaaagttgtggcagagcgcctgaacgtaaaagaa gaagatatccagaatagctcttctttcacagaagacctgggtgctgactctctggacacc gttgaactggtgatggcgttggaagaggaattcgacaccgaaattcctgacgaagaagcc gagaagatcaccacggttcaggaagccatcgactacgtgaacgcccaccagtaa

DBGET integrated database retrieval system