KEGG   Hippoglossus hippoglossus (Atlantic halibut): 117764499
Entry
117764499         CDS       T07778                                 
Symbol
timm17b
Name
(RefSeq) mitochondrial import inner membrane translocase subunit Tim17-B
  KO
K17795  mitochondrial import inner membrane translocase subunit TIM17
Organism
hhip  Hippoglossus hippoglossus (Atlantic halibut)
Brite
KEGG Orthology (KO) [BR:hhip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hhip03029]
    117764499 (timm17b)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hhip02000]
    117764499 (timm17b)
Mitochondrial biogenesis [BR:hhip03029]
 Mitochondrial protein import machinery
  Inner mambrane
   TIM23 complex
    117764499 (timm17b)
Transporters [BR:hhip02000]
 Other transporters
  Primary active transporters [TC:3]
   117764499 (timm17b)
SSDB
Motif
Pfam: Tim17
Other DBs
NCBI-GeneID: 117764499
NCBI-ProteinID: XP_034446229
LinkDB
Position
7:23209464..23213551
AA seq 168 aa
MEEYAREPCPWRIVDDCGGAFTMGAIGGGVFQSLKGFRNAPAGVAHRLRGSTNAVRVRAP
QIGGSFAVWGGLFSTIDCGLVRVRGKEDPWNSITSGALTGAILAARSGPLAMMGSAMMGG
ILLALIEGFGILLTRYTAQQFQNPVPFADDPSQLPPKDAAQVSGSVKE
NT seq 507 nt   +upstreamnt  +downstreamnt
atggaggaatatgcccgcgagccctgtccgtggaggatagtggacgactgcggcggcgct
ttcaccatgggtgcaatcggtggaggggtgttccagtcactcaagggctttcgtaatgcc
cctgctggtgtcgcacaccgactgagaggcagcaccaatgcagtgagagtacgagctcca
cagattggagggagctttgctgtgtgggggggtctcttctccacaattgactgtggtctg
gttcgcgtcagagggaaagaagacccgtggaactctataacaagcggagcgctgactgga
gctatcctggcagcgcgcagtgggcccttagccatgatgggctctgccatgatggggggg
attttgctggctctcattgagggttttgggatcctcctcaccagatacacagcgcagcag
tttcagaatcctgttccctttgcagacgaccccagtcagttgcctccaaaagatgcagca
caagtgtcaggaagcgttaaggaatga

DBGET integrated database retrieval system