Hungatella hathewayi: NQ487_28540 Help Entry NQ487_28540       CDS       T08453                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism hhj  Hungatella hathewayi Pathway hhj00020   Citrate cycle (TCA cycle) hhj00720   Other carbon fixation pathways hhj01100   Metabolic pathways hhj01110   Biosynthesis of secondary metabolites hhj01120   Microbial metabolism in diverse environments hhj01200   Carbon metabolism hhj01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:hhj00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     NQ487_28540   09102 Energy metabolism    00720 Other carbon fixation pathways     NQ487_28540 Enzymes [BR:hhj01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      NQ487_28540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_6 Fer4_21 Fer4_7 Fer4_2 Fer4_9 Fer4_16 Fer4_4 Fer4_13 LdpA_Fe-S-bd Fer4_3 Fer4_15 Fer4_17 Fer4_8 Fer4_22 Motif Other DBs NCBI-ProteinID:  UWO84751 LinkDB All DBs Position 6236553..6236771 Genome browser AA seq 72 aa AA seqDB search MKVIVNKDRCKECGLCIHHCPKQAISKCNTLNAGGYYPVQVDDEACIACGMCYITCPDGV FYISGDIEEEVQ NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcattgttaataaagaccggtgcaaggaatgtgggttgtgtatccatcactgt cccaaacaggccatcagtaaatgtaatactctgaacgcaggcggttattatcctgtccag gtggatgatgaggcgtgtatcgcctgtggaatgtgctatatcacatgtccagacggtgta ttctacatatcaggagatatagaagaggaggttcaatga

DBGET integrated database retrieval system