Halorhodospira halochloris: HH1059_12980 Help Entry HH1059_12980      CDS       T06158                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hhk  Halorhodospira halochloris Pathway hhk01100   Metabolic pathways hhk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hhk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HH1059_12980 (acpP)    00074 Mycolic acid biosynthesis     HH1059_12980 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HH1059_12980 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  BAU58006 UniProt:  A0A0X8X9L7 LinkDB All DBs Position complement(1408629..1408868) Genome browser AA seq 79 aa AA seqDB search MSSIEDRVKKIVVEQLGVKDEEVTGEASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAVDYINKHLEG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagcatcgaagatcgcgtcaagaagattgtcgtagagcaattaggggttaaggat gaggaagtgacgggcgaggcatccttcgtcgatgacctgggagccgactccctcgacact gtagagctggtaatggcacttgaagaagagttcgagtgtgaaatccccgacgaggaagcc gaaaaaatcacgacggttcagcaagcggtcgactatatcaataagcatctggaggggtga

DBGET integrated database retrieval system