Halobacteroides halobius: Halha_1417 Help Entry Halha_1417        CDS       T02401                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hhl  Halobacteroides halobius Pathway hhl01100   Metabolic pathways hhl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hhl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Halha_1417    00074 Mycolic acid biosynthesis     Halha_1417   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Halha_1417 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  AGB41362 UniProt:  L0K7X3 LinkDB All DBs Position complement(1419304..1419531) Genome browser AA seq 75 aa AA seqDB search MDVLETVKEIIAEELMLDEDEVTAEATFDDLGADSLDIVEIVMAFEDEFDVEIPDEDAEE IQTVQDAVDYINDLL NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggatgtattagaaactgtaaaggaaattattgcagaagaattaatgttagatgaagat gaagttactgctgaggctacttttgatgatctaggagctgattctctagatattgtagaa attgtaatggcctttgaggatgagtttgatgttgaaattcctgatgaagatgctgaggaa attcaaactgtacaggatgctgtagattacattaatgatcttttataa

DBGET integrated database retrieval system