KEGG   Hydrogenobaculum sp. HO: HydHO_1362
Entry
HydHO_1362        CDS       T02482                                 

Name
(GenBank) Citrate synthase
  KO
K15234  citryl-CoA lyase [EC:4.1.3.34]
Organism
hho  Hydrogenobaculum sp. HO
Pathway
hho00720  Carbon fixation pathways in prokaryotes
hho01100  Metabolic pathways
hho01120  Microbial metabolism in diverse environments
hho01200  Carbon metabolism
Module
hho_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:hho00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HydHO_1362
Enzymes [BR:hho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.34  citryl-CoA lyase
     HydHO_1362
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: AGG15673
UniProt: M1QK81
LinkDB
Position
complement(1281331..1282104)
AA seq 257 aa
MEKKWRTGITLHKGEDTYIRGYKLLDLVGNLSFSQAIYLILKGELPSEKEAKMMDAIFVS
VIDHGIAPPSVIAARAVASGGNTLNVGVAAGVATFGSAHGGALEDAMKFMQDNINKNIEE
LVKEYLENKKPIPGFGHKYYKEFDPRTKRLMDIAKSLGFYDKYCAFAEKVEEEILKQKGK
KLVLNVDGAIAAVTSEMGFDWRLGKGFFIIGRVPGLVAHVYEELTKEKPFSKRLNEKEET
EYTGIEPRELPQEFKKF
NT seq 774 nt   +upstreamnt  +downstreamnt
atggaaaaaaaatggcgtaccggtatcactcttcacaaaggcgaagacacctatataaga
ggttacaagctattagacttagtaggtaaccttagcttttcacaagcgatatatctaata
ttaaaaggtgagctgccatctgaaaaagaagccaagatgatggatgctatctttgtatct
gtaatagaccacggcatagctccaccttctgtaatagctgcaagagctgtagcctctggt
ggcaacacgctaaacgtaggagtagccgctggtgttgcgacatttggttctgctcacggt
ggggctttggaagatgcgatgaagtttatgcaagataacataaacaaaaatatagaagag
cttgtaaaagaatatcttgaaaataaaaaaccaatacctggttttggacataaatactac
aaagaatttgacccaaggacaaagaggctgatggatatagctaaatctttgggcttttac
gataagtattgtgcttttgcagaaaaagtagaagaagagatacttaaacaaaagggcaaa
aagctcgtgttaaacgtagacggtgccatagctgctgttacatcggaaatggggtttgat
tggaggcttggtaaaggatttttcataataggaagggttcctgggcttgtagctcacgta
tacgaagaacttaccaaagaaaagccttttagcaagagattaaacgaaaaggaagaaact
gaatacaccgggatagaaccaagagagcttcctcaagagtttaaaaagttttaa

DBGET integrated database retrieval system