Helicobacter pylori Shi112: HPSH112_04230 Help Entry HPSH112_04230     CDS       T02037                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hhp  Helicobacter pylori Shi112 Pathway hhp01100   Metabolic pathways hhp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hhp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPSH112_04230 (acpP)    00074 Mycolic acid biosynthesis     HPSH112_04230 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPSH112_04230 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AFI01047 LinkDB All DBs Position 853003..853239 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcagca caagttacgccagaagcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system