Helicobacter pylori Shi169: HPSH169_02885 Help Entry HPSH169_02885     CDS       T02038                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hhq  Helicobacter pylori Shi169 Pathway hhq01100   Metabolic pathways hhq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hhq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPSH169_02885 (acpP)    00074 Mycolic acid biosynthesis     HPSH169_02885 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPSH169_02885 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AFH99275 UniProt:  A0A0E0WD52 LinkDB All DBs Position complement(583245..583481) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggca caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaactaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system