Halodesulfurarchaeum formicicum HSR6: HSR6_1969 Help Entry HSR6_1969         CDS       T04550                                  Symbol rpl40e Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hhsr  Halodesulfurarchaeum formicicum HSR6 Pathway hhsr03010   Ribosome Brite KEGG Orthology (KO) [BR:hhsr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HSR6_1969 (rpl40e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HSR6_1969 (rpl40e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hhsr03011]     HSR6_1969 (rpl40e)    04121 Ubiquitin system [BR:hhsr04121]     HSR6_1969 (rpl40e) Ribosome [BR:hhsr03011]  Ribosomal proteins   Eukaryotes    Large subunit     HSR6_1969 (rpl40e)   Archaea     HSR6_1969 (rpl40e) Ubiquitin system [BR:hhsr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HSR6_1969 (rpl40e) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DUF6395 DZR_2 Cas12f1-like_TNB DUF6079_6th DHHC Zn_ribbon_3 Zn_ribbon_GTF2H2 Zn_ribbon_RPAB4 DUF7577 Motif Other DBs NCBI-ProteinID:  APE96400 UniProt:  A0A1D8S6T1 LinkDB All DBs Position complement(1925779..1925928) Genome browser AA seq 49 aa AA seqDB search MTQHLSIEDRLLGTQVCMRCNARNPERAERCRKCGYKNLRPKAKERRAT NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atgacacagcacctctcgatcgaggaccggcttctgggcacccaggtctgcatgcggtgt aacgcccgaaaccccgagcgtgccgagcgctgtcgcaagtgtggctacaagaacttgcgc ccgaaggccaaggaacgccgcgcgacctaa

DBGET integrated database retrieval system