Halodesulfurarchaeum formicicum HSR6: HSR6_1988 Help Entry HSR6_1988         CDS       T04550                                  Symbol rps27ae Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hhsr  Halodesulfurarchaeum formicicum HSR6 Pathway hhsr03010   Ribosome Brite KEGG Orthology (KO) [BR:hhsr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HSR6_1988 (rps27ae)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HSR6_1988 (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hhsr03011]     HSR6_1988 (rps27ae)    04121 Ubiquitin system [BR:hhsr04121]     HSR6_1988 (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhsr04147]     HSR6_1988 (rps27ae) Ribosome [BR:hhsr03011]  Ribosomal proteins   Eukaryotes    Small subunit     HSR6_1988 (rps27ae)   Archaea     HSR6_1988 (rps27ae) Ubiquitin system [BR:hhsr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HSR6_1988 (rps27ae) Exosome [BR:hhsr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HSR6_1988 (rps27ae)   Exosomal proteins of colorectal cancer cells    HSR6_1988 (rps27ae) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_RPB9 DZR FlhC HypA Motif Other DBs NCBI-ProteinID:  APE96419 UniProt:  A0A1D8S6V2 LinkDB All DBs Position 1940855..1940986 Genome browser AA seq 43 aa AA seqDB search MARGDFYEDGELAKERCPRCEDAFLADHDDRKHCGRCGYTEWK NT seq 132 nt NT seq  +upstreamnt  +downstreamnt atggctcgcggcgatttctacgaggacggcgaactcgcgaaggaacgctgccctcgctgt gaggacgcgttcctcgccgaccacgacgaccgcaagcactgcggtcgctgtggctacacc gagtggaagtga

DBGET integrated database retrieval system