Herbaspirillum hiltneri: F506_21425 Help Entry F506_21425        CDS       T04039                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism hht  Herbaspirillum hiltneri Brite KEGG Orthology (KO) [BR:hht00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hht03110]     F506_21425 Chaperones and folding catalysts [BR:hht03110]  Protein folding catalysts   Protein disulfide isomerase    F506_21425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like DSBA Motif Other DBs NCBI-ProteinID:  AKZ64873 UniProt:  A0ABM5V5Q7 LinkDB All DBs Position 4748589..4748849 Genome browser AA seq 86 aa AA seqDB search MTARVLMYSTGVCPYCMMAERLLKSKGVDDIEKIRVDLDPQQKDIMMEKTGRRTVPQIYI GDTHVGGFDDLSALDRAGGLDPLLQG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacagcgcgcgtcctcatgtacagcaccggcgtgtgcccctattgcatgatggccgag cgtctgctcaagagcaagggcgtcgatgacatcgaaaagatccgtgtcgacctcgatccg cagcagaaggacatcatgatggagaagaccggccgccgcacggtgccgcaaatctacatc ggcgatacccacgtcggcggtttcgacgacctcagcgcattggaccgcgccggcggtctt gatccgctgctgcagggctga

DBGET integrated database retrieval system