Hyaena hyaena (striped hyena): 120222031 Help Entry 120222031         CDS       T07257                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04014   Ras signaling pathway hhv04137   Mitophagy - animal hhv04144   Endocytosis hhv04145   Phagosome hhv04148   Efferocytosis hhv04962   Vasopressin-regulated water reabsorption hhv05014   Amyotrophic lateral sclerosis hhv05022   Pathways of neurodegeneration - multiple diseases hhv05132   Salmonella infection hhv05146   Amoebiasis hhv05152   Tuberculosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     120222031 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120222031 (RAB5A)    04145 Phagosome     120222031 (RAB5A)    04137 Mitophagy - animal     120222031 (RAB5A)    04148 Efferocytosis     120222031 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     120222031 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120222031 (RAB5A)    05152 Tuberculosis     120222031 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     120222031 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     120222031 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     120222031 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hhv04131]     120222031 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhv04147]     120222031 (RAB5A)    04031 GTP-binding proteins [BR:hhv04031]     120222031 (RAB5A) Membrane trafficking [BR:hhv04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     120222031 (RAB5A)  Endosome - Lysosome transport     120222031 (RAB5A) Exosome [BR:hhv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120222031 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    120222031 (RAB5A)   Exosomal proteins of colorectal cancer cells    120222031 (RAB5A)   Exosomal proteins of bladder cancer cells    120222031 (RAB5A) GTP-binding proteins [BR:hhv04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     120222031 (RAB5A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  120222031 NCBI-ProteinID:  XP_039075647 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgctacgtttt gtgaagggccagtttcatgaatttcaagagagtaccataggggctgcttttctaacccaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagcgg caagccagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa agagctgttgattttcaggaagcacagtcctatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctgccagaggaagaggagtagac cttactgaacccacgcagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system