Hyaena hyaena (striped hyena): 120223242 Help Entry 120223242         CDS       T07257                                  Name (RefSeq) interferon alpha-like   KO K05414   interferon alpha Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04060   Cytokine-cytokine receptor interaction hhv04151   PI3K-Akt signaling pathway hhv04217   Necroptosis hhv04620   Toll-like receptor signaling pathway hhv04621   NOD-like receptor signaling pathway hhv04622   RIG-I-like receptor signaling pathway hhv04623   Cytosolic DNA-sensing pathway hhv04630   JAK-STAT signaling pathway hhv04650   Natural killer cell mediated cytotoxicity hhv04936   Alcoholic liver disease hhv05152   Tuberculosis hhv05160   Hepatitis C hhv05161   Hepatitis B hhv05162   Measles hhv05163   Human cytomegalovirus infection hhv05164   Influenza A hhv05165   Human papillomavirus infection hhv05167   Kaposi sarcoma-associated herpesvirus infection hhv05168   Herpes simplex virus 1 infection hhv05169   Epstein-Barr virus infection hhv05170   Human immunodeficiency virus 1 infection hhv05171   Coronavirus disease - COVID-19 hhv05200   Pathways in cancer hhv05320   Autoimmune thyroid disease hhv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120223242    04151 PI3K-Akt signaling pathway     120223242   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120223242  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120223242  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120223242    04621 NOD-like receptor signaling pathway     120223242    04622 RIG-I-like receptor signaling pathway     120223242    04623 Cytosolic DNA-sensing pathway     120223242    04650 Natural killer cell mediated cytotoxicity     120223242  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120223242   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120223242    05161 Hepatitis B     120223242    05160 Hepatitis C     120223242    05171 Coronavirus disease - COVID-19     120223242    05164 Influenza A     120223242    05162 Measles     120223242    05168 Herpes simplex virus 1 infection     120223242    05163 Human cytomegalovirus infection     120223242    05167 Kaposi sarcoma-associated herpesvirus infection     120223242    05169 Epstein-Barr virus infection     120223242    05165 Human papillomavirus infection     120223242   09171 Infectious disease: bacterial    05152 Tuberculosis     120223242   09163 Immune disease    05320 Autoimmune thyroid disease     120223242   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120223242   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120223242  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhv04052]     120223242 Cytokines and neuropeptides [BR:hhv04052]  Cytokines   Interferons    120223242 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  120223242 NCBI-ProteinID:  XP_039077193 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MAPPSSFLTALVVLSCSSVCSLGCEPPHTHGLPHRGALTLLGHMRTLPAASCQKDRSDFA FPTDAFDGSRLQKAQALSVLHATNQKLFQLFCTEASASAAWNGALLDEFCAGLEQQLTHL EACLTRDAGARDAPLTNEESALRDYFQRISLYLREKKYSPCAWEIVRAEIMRAVYSSTAL HRRLRSDK NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggcgccgcccagctccttcctgacggccctggtggtgctcagctgcagctccgtctgc tctctgggctgtgagccgcctcacacccacggcctgccccacaggggggccttgacgctc ctgggacacatgcggacgctccctgccgcctcctgccagaaggacagaagtgactttgcc ttccccacggacgcgtttgatggcagccggctccagaaggctcaggccctctctgtgctc cacgcgaccaaccagaagctcttccagctcttctgcacggaggcctccgcgtctgccgcc tggaatggcgccctcctggacgagttctgcgcggggctggagcagcagctcacccacctg gaagcctgtctcacgcgggacgcgggggcccgagacgctcccctcacgaatgaggagtcc gcactgagggactacttccaaagaatctctctctacctgcgagagaagaagtacagcccc tgcgcctgggagatcgtcagagcggaaatcatgagagccgtgtattcatcgacggccttg cacagaagattaaggagcgacaagtga

DBGET integrated database retrieval system