Hyaena hyaena (striped hyena): 120223392 Help Entry 120223392         CDS       T07257                                  Symbol HRAS Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv01521   EGFR tyrosine kinase inhibitor resistance hhv01522   Endocrine resistance hhv04010   MAPK signaling pathway hhv04012   ErbB signaling pathway hhv04014   Ras signaling pathway hhv04015   Rap1 signaling pathway hhv04062   Chemokine signaling pathway hhv04068   FoxO signaling pathway hhv04071   Sphingolipid signaling pathway hhv04072   Phospholipase D signaling pathway hhv04137   Mitophagy - animal hhv04140   Autophagy - animal hhv04144   Endocytosis hhv04150   mTOR signaling pathway hhv04151   PI3K-Akt signaling pathway hhv04210   Apoptosis hhv04211   Longevity regulating pathway hhv04213   Longevity regulating pathway - multiple species hhv04218   Cellular senescence hhv04360   Axon guidance hhv04370   VEGF signaling pathway hhv04371   Apelin signaling pathway hhv04510   Focal adhesion hhv04540   Gap junction hhv04550   Signaling pathways regulating pluripotency of stem cells hhv04625   C-type lectin receptor signaling pathway hhv04630   JAK-STAT signaling pathway hhv04650   Natural killer cell mediated cytotoxicity hhv04660   T cell receptor signaling pathway hhv04662   B cell receptor signaling pathway hhv04664   Fc epsilon RI signaling pathway hhv04714   Thermogenesis hhv04720   Long-term potentiation hhv04722   Neurotrophin signaling pathway hhv04725   Cholinergic synapse hhv04726   Serotonergic synapse hhv04730   Long-term depression hhv04810   Regulation of actin cytoskeleton hhv04910   Insulin signaling pathway hhv04912   GnRH signaling pathway hhv04915   Estrogen signaling pathway hhv04916   Melanogenesis hhv04917   Prolactin signaling pathway hhv04919   Thyroid hormone signaling pathway hhv04921   Oxytocin signaling pathway hhv04926   Relaxin signaling pathway hhv04929   GnRH secretion hhv04933   AGE-RAGE signaling pathway in diabetic complications hhv04935   Growth hormone synthesis, secretion and action hhv05010   Alzheimer disease hhv05022   Pathways of neurodegeneration - multiple diseases hhv05034   Alcoholism hhv05132   Salmonella infection hhv05160   Hepatitis C hhv05161   Hepatitis B hhv05163   Human cytomegalovirus infection hhv05165   Human papillomavirus infection hhv05166   Human T-cell leukemia virus 1 infection hhv05167   Kaposi sarcoma-associated herpesvirus infection hhv05170   Human immunodeficiency virus 1 infection hhv05200   Pathways in cancer hhv05203   Viral carcinogenesis hhv05205   Proteoglycans in cancer hhv05206   MicroRNAs in cancer hhv05207   Chemical carcinogenesis - receptor activation hhv05208   Chemical carcinogenesis - reactive oxygen species hhv05210   Colorectal cancer hhv05211   Renal cell carcinoma hhv05213   Endometrial cancer hhv05214   Glioma hhv05215   Prostate cancer hhv05216   Thyroid cancer hhv05218   Melanoma hhv05219   Bladder cancer hhv05220   Chronic myeloid leukemia hhv05221   Acute myeloid leukemia hhv05223   Non-small cell lung cancer hhv05224   Breast cancer hhv05225   Hepatocellular carcinoma hhv05226   Gastric cancer hhv05230   Central carbon metabolism in cancer hhv05231   Choline metabolism in cancer hhv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer hhv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120223392 (HRAS)    04012 ErbB signaling pathway     120223392 (HRAS)    04014 Ras signaling pathway     120223392 (HRAS)    04015 Rap1 signaling pathway     120223392 (HRAS)    04370 VEGF signaling pathway     120223392 (HRAS)    04371 Apelin signaling pathway     120223392 (HRAS)    04630 JAK-STAT signaling pathway     120223392 (HRAS)    04068 FoxO signaling pathway     120223392 (HRAS)    04072 Phospholipase D signaling pathway     120223392 (HRAS)    04071 Sphingolipid signaling pathway     120223392 (HRAS)    04151 PI3K-Akt signaling pathway     120223392 (HRAS)    04150 mTOR signaling pathway     120223392 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120223392 (HRAS)    04140 Autophagy - animal     120223392 (HRAS)    04137 Mitophagy - animal     120223392 (HRAS)   09143 Cell growth and death    04210 Apoptosis     120223392 (HRAS)    04218 Cellular senescence     120223392 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120223392 (HRAS)    04540 Gap junction     120223392 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     120223392 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120223392 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120223392 (HRAS)    04650 Natural killer cell mediated cytotoxicity     120223392 (HRAS)    04660 T cell receptor signaling pathway     120223392 (HRAS)    04662 B cell receptor signaling pathway     120223392 (HRAS)    04664 Fc epsilon RI signaling pathway     120223392 (HRAS)    04062 Chemokine signaling pathway     120223392 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     120223392 (HRAS)    04929 GnRH secretion     120223392 (HRAS)    04912 GnRH signaling pathway     120223392 (HRAS)    04915 Estrogen signaling pathway     120223392 (HRAS)    04917 Prolactin signaling pathway     120223392 (HRAS)    04921 Oxytocin signaling pathway     120223392 (HRAS)    04926 Relaxin signaling pathway     120223392 (HRAS)    04935 Growth hormone synthesis, secretion and action     120223392 (HRAS)    04919 Thyroid hormone signaling pathway     120223392 (HRAS)    04916 Melanogenesis     120223392 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     120223392 (HRAS)    04726 Serotonergic synapse     120223392 (HRAS)    04720 Long-term potentiation     120223392 (HRAS)    04730 Long-term depression     120223392 (HRAS)    04722 Neurotrophin signaling pathway     120223392 (HRAS)   09158 Development and regeneration    04360 Axon guidance     120223392 (HRAS)   09149 Aging    04211 Longevity regulating pathway     120223392 (HRAS)    04213 Longevity regulating pathway - multiple species     120223392 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     120223392 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120223392 (HRAS)    05206 MicroRNAs in cancer     120223392 (HRAS)    05205 Proteoglycans in cancer     120223392 (HRAS)    05207 Chemical carcinogenesis - receptor activation     120223392 (HRAS)    05208 Chemical carcinogenesis - reactive oxygen species     120223392 (HRAS)    05203 Viral carcinogenesis     120223392 (HRAS)    05230 Central carbon metabolism in cancer     120223392 (HRAS)    05231 Choline metabolism in cancer     120223392 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120223392 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     120223392 (HRAS)    05225 Hepatocellular carcinoma     120223392 (HRAS)    05226 Gastric cancer     120223392 (HRAS)    05214 Glioma     120223392 (HRAS)    05216 Thyroid cancer     120223392 (HRAS)    05221 Acute myeloid leukemia     120223392 (HRAS)    05220 Chronic myeloid leukemia     120223392 (HRAS)    05218 Melanoma     120223392 (HRAS)    05211 Renal cell carcinoma     120223392 (HRAS)    05219 Bladder cancer     120223392 (HRAS)    05215 Prostate cancer     120223392 (HRAS)    05213 Endometrial cancer     120223392 (HRAS)    05224 Breast cancer     120223392 (HRAS)    05223 Non-small cell lung cancer     120223392 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120223392 (HRAS)    05170 Human immunodeficiency virus 1 infection     120223392 (HRAS)    05161 Hepatitis B     120223392 (HRAS)    05160 Hepatitis C     120223392 (HRAS)    05163 Human cytomegalovirus infection     120223392 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     120223392 (HRAS)    05165 Human papillomavirus infection     120223392 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     120223392 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     120223392 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     120223392 (HRAS)   09165 Substance dependence    05034 Alcoholism     120223392 (HRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120223392 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     120223392 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     120223392 (HRAS)    01522 Endocrine resistance     120223392 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hhv04131]     120223392 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhv04147]     120223392 (HRAS)    04031 GTP-binding proteins [BR:hhv04031]     120223392 (HRAS) Membrane trafficking [BR:hhv04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120223392 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     120223392 (HRAS) Exosome [BR:hhv04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    120223392 (HRAS)   Exosomal proteins of colorectal cancer cells    120223392 (HRAS) GTP-binding proteins [BR:hhv04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120223392 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  120223392 NCBI-ProteinID:  XP_039077402 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSGSSSGTPVTQRPLALAWRMPSTRW SERSGNTRCGS NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagctcgtggtggtgggcgctggaggtgtggggaagagtgccctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccattgaggactcatat cggaagcaagtggttattgacggtgagacgtgcctgctggacattttggacacggcgggc caggaggagtatagcgccatgcgggaccagtacatgcgcaccggagaaggcttcctctgc gtgtttgccataaacaacaccaagtccttcgaagacatccaccagtacagggagcagatc aagcgggtgaaggactccgacgacgtgcccatggtgctggtggggaacaagtgcgacctg gctgcgcgtactgtggagtctcggcaggcgcaggacctcgcccgcagctatggcatcccg tacattgagacgtcagccaagactcgccagggcagccgctctggctctggctccagctcc gggacccccgtgacccagcggcccctagcgctggcgtggaggatgccttctacacgctgg tccgagagatccggcaacacaaggtgcggaagctga

DBGET integrated database retrieval system