Hyaena hyaena (striped hyena): 120226896 Help Entry 120226896         CDS       T07257                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04010   MAPK signaling pathway hhv04014   Ras signaling pathway hhv04015   Rap1 signaling pathway hhv04022   cGMP-PKG signaling pathway hhv04066   HIF-1 signaling pathway hhv04068   FoxO signaling pathway hhv04072   Phospholipase D signaling pathway hhv04081   Hormone signaling hhv04114   Oocyte meiosis hhv04140   Autophagy - animal hhv04150   mTOR signaling pathway hhv04151   PI3K-Akt signaling pathway hhv04152   AMPK signaling pathway hhv04211   Longevity regulating pathway hhv04213   Longevity regulating pathway - multiple species hhv04810   Regulation of actin cytoskeleton hhv04910   Insulin signaling pathway hhv04911   Insulin secretion hhv04913   Ovarian steroidogenesis hhv04914   Progesterone-mediated oocyte maturation hhv04917   Prolactin signaling pathway hhv04923   Regulation of lipolysis in adipocytes hhv04930   Type II diabetes mellitus hhv04931   Insulin resistance hhv04932   Non-alcoholic fatty liver disease hhv04940   Type I diabetes mellitus hhv04950   Maturity onset diabetes of the young hhv04960   Aldosterone-regulated sodium reabsorption hhv05010   Alzheimer disease hhv05215   Prostate cancer hhv05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120226896 (INS)    04014 Ras signaling pathway     120226896 (INS)    04015 Rap1 signaling pathway     120226896 (INS)    04066 HIF-1 signaling pathway     120226896 (INS)    04068 FoxO signaling pathway     120226896 (INS)    04072 Phospholipase D signaling pathway     120226896 (INS)    04022 cGMP-PKG signaling pathway     120226896 (INS)    04151 PI3K-Akt signaling pathway     120226896 (INS)    04152 AMPK signaling pathway     120226896 (INS)    04150 mTOR signaling pathway     120226896 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     120226896 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120226896 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     120226896 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120226896 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     120226896 (INS)    04910 Insulin signaling pathway     120226896 (INS)    04923 Regulation of lipolysis in adipocytes     120226896 (INS)    04913 Ovarian steroidogenesis     120226896 (INS)    04914 Progesterone-mediated oocyte maturation     120226896 (INS)    04917 Prolactin signaling pathway     120226896 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     120226896 (INS)   09149 Aging    04211 Longevity regulating pathway     120226896 (INS)    04213 Longevity regulating pathway - multiple species     120226896 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     120226896 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     120226896 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     120226896 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     120226896 (INS)    04940 Type I diabetes mellitus     120226896 (INS)    04950 Maturity onset diabetes of the young     120226896 (INS)    04932 Non-alcoholic fatty liver disease     120226896 (INS)    04931 Insulin resistance     120226896 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhv04052]     120226896 (INS) Cytokines and neuropeptides [BR:hhv04052]  Neuropeptides   Unclassified    120226896 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  120226896 NCBI-ProteinID:  XP_039081000 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MALWTRLLPLLALLALWTPAPTHAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAED PQARDVELGGAPSAGGLQPPAPGGPLRKRGIVEQCCTSICSLYQLENYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacgcgcctcctgcccctgctcgctctgctggccctctggacgccggcc ccgacccacgccttcgtcaaccagcacctgtgcggctcccacctggtggaggcgctgtac ctggtgtgcggggagcgaggcttcttctacacgcccaaggcccgccgggaggcggaggac cctcaggcgagggacgtggagctggggggcgcacccagcgcgggcggcctgcagcctccg gccccgggggggcccctgcggaagcggggcatcgtggagcagtgctgcaccagcatctgc tccctgtaccagctggagaattactgcaactag

DBGET integrated database retrieval system