Hyaena hyaena (striped hyena): 120227296 Help Entry 120227296         CDS       T07257                                  Name (RefSeq) C-C motif chemokine 2-like   KO K14624   C-C motif chemokine 2 Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04060   Cytokine-cytokine receptor interaction hhv04061   Viral protein interaction with cytokine and cytokine receptor hhv04062   Chemokine signaling pathway hhv04621   NOD-like receptor signaling pathway hhv04657   IL-17 signaling pathway hhv04668   TNF signaling pathway hhv04933   AGE-RAGE signaling pathway in diabetic complications hhv05135   Yersinia infection hhv05142   Chagas disease hhv05144   Malaria hhv05163   Human cytomegalovirus infection hhv05164   Influenza A hhv05168   Herpes simplex virus 1 infection hhv05171   Coronavirus disease - COVID-19 hhv05323   Rheumatoid arthritis hhv05417   Lipid and atherosclerosis hhv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     120227296   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120227296    04061 Viral protein interaction with cytokine and cytokine receptor     120227296  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120227296    04657 IL-17 signaling pathway     120227296    04062 Chemokine signaling pathway     120227296  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     120227296    05164 Influenza A     120227296    05168 Herpes simplex virus 1 infection     120227296    05163 Human cytomegalovirus infection     120227296   09171 Infectious disease: bacterial    05135 Yersinia infection     120227296   09174 Infectious disease: parasitic    05144 Malaria     120227296    05142 Chagas disease     120227296   09163 Immune disease    05323 Rheumatoid arthritis     120227296   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120227296    05418 Fluid shear stress and atherosclerosis     120227296   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     120227296  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhv04052]     120227296    00536 Glycosaminoglycan binding proteins [BR:hhv00536]     120227296 Cytokines and neuropeptides [BR:hhv04052]  Cytokines   Chemokines    120227296 Glycosaminoglycan binding proteins [BR:hhv00536]  Heparan sulfate / Heparin   Chemokines    120227296 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  120227296 NCBI-ProteinID:  XP_039081367 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MKVSAALLCLLLTAATFSIQTLAQPDAINSPVTCCYTFTNKKISMQKLVSYKRVTSSKCP KEAVIFKTIVNKEFCADPNQKWVKDSMAHLDKKTQTAKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaagtctccgcagcgcttctgtgcctgctgctcacagctgccaccttcagcatccag acgcttgcccagcctgatgcaattaattctccagtcacctgctgctatacattcaccaat aagaagatctcgatgcagaagctggtgagctataaaagagtcaccagcagcaagtgtcct aaagaagcagtgatcttcaagaccatcgtaaacaaggagttctgtgctgacccaaaccag aagtgggtcaaggattccatggcacatctggacaagaaaacccaaactgcaaagccttga

DBGET integrated database retrieval system