Hyaena hyaena (striped hyena): 120229394 Help Entry 120229394         CDS       T07257                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04014   Ras signaling pathway hhv04015   Rap1 signaling pathway hhv04022   cGMP-PKG signaling pathway hhv04024   cAMP signaling pathway hhv04062   Chemokine signaling pathway hhv04071   Sphingolipid signaling pathway hhv04072   Phospholipase D signaling pathway hhv04081   Hormone signaling hhv04144   Endocytosis hhv04150   mTOR signaling pathway hhv04270   Vascular smooth muscle contraction hhv04310   Wnt signaling pathway hhv04350   TGF-beta signaling pathway hhv04360   Axon guidance hhv04510   Focal adhesion hhv04520   Adherens junction hhv04530   Tight junction hhv04611   Platelet activation hhv04621   NOD-like receptor signaling pathway hhv04625   C-type lectin receptor signaling pathway hhv04660   T cell receptor signaling pathway hhv04670   Leukocyte transendothelial migration hhv04722   Neurotrophin signaling pathway hhv04810   Regulation of actin cytoskeleton hhv04921   Oxytocin signaling pathway hhv04928   Parathyroid hormone synthesis, secretion and action hhv04972   Pancreatic secretion hhv05100   Bacterial invasion of epithelial cells hhv05132   Salmonella infection hhv05133   Pertussis hhv05135   Yersinia infection hhv05152   Tuberculosis hhv05163   Human cytomegalovirus infection hhv05200   Pathways in cancer hhv05203   Viral carcinogenesis hhv05205   Proteoglycans in cancer hhv05206   MicroRNAs in cancer hhv05210   Colorectal cancer hhv05417   Lipid and atherosclerosis hhv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     120229394 (RHOA)    04015 Rap1 signaling pathway     120229394 (RHOA)    04310 Wnt signaling pathway     120229394 (RHOA)    04350 TGF-beta signaling pathway     120229394 (RHOA)    04072 Phospholipase D signaling pathway     120229394 (RHOA)    04071 Sphingolipid signaling pathway     120229394 (RHOA)    04024 cAMP signaling pathway     120229394 (RHOA)    04022 cGMP-PKG signaling pathway     120229394 (RHOA)    04150 mTOR signaling pathway     120229394 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     120229394 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120229394 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120229394 (RHOA)    04520 Adherens junction     120229394 (RHOA)    04530 Tight junction     120229394 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120229394 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     120229394 (RHOA)    04621 NOD-like receptor signaling pathway     120229394 (RHOA)    04625 C-type lectin receptor signaling pathway     120229394 (RHOA)    04660 T cell receptor signaling pathway     120229394 (RHOA)    04670 Leukocyte transendothelial migration     120229394 (RHOA)    04062 Chemokine signaling pathway     120229394 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     120229394 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     120229394 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     120229394 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     120229394 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     120229394 (RHOA)   09158 Development and regeneration    04360 Axon guidance     120229394 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120229394 (RHOA)    05206 MicroRNAs in cancer     120229394 (RHOA)    05205 Proteoglycans in cancer     120229394 (RHOA)    05203 Viral carcinogenesis     120229394 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     120229394 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     120229394 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     120229394 (RHOA)    05135 Yersinia infection     120229394 (RHOA)    05133 Pertussis     120229394 (RHOA)    05152 Tuberculosis     120229394 (RHOA)    05100 Bacterial invasion of epithelial cells     120229394 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120229394 (RHOA)    05418 Fluid shear stress and atherosclerosis     120229394 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hhv04131]     120229394 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhv04147]     120229394 (RHOA)    04031 GTP-binding proteins [BR:hhv04031]     120229394 (RHOA) Membrane trafficking [BR:hhv04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     120229394 (RHOA) Exosome [BR:hhv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120229394 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    120229394 (RHOA)   Exosomal proteins of colorectal cancer cells    120229394 (RHOA)   Exosomal proteins of bladder cancer cells    120229394 (RHOA) GTP-binding proteins [BR:hhv04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     120229394 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  120229394 NCBI-ProteinID:  XP_039084323 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata ctgatgtgtttctccatcgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcacttctgccccaatgtgcccatcatcctggttgggaacaagaaggat cttcggaatgatgagcacacaaggcgggagctggccaagatgaagcaggagccagtgaaa ccggaagaaggcagagatatggcgaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system