Hyaena hyaena (striped hyena): 120229702 Help Entry 120229702         CDS       T07257                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04146   Peroxisome hhv04213   Longevity regulating pathway - multiple species hhv05012   Parkinson disease hhv05014   Amyotrophic lateral sclerosis hhv05016   Huntington disease hhv05020   Prion disease hhv05022   Pathways of neurodegeneration - multiple diseases hhv05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:hhv00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     120229702 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     120229702 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     120229702 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     120229702 (SOD1)    05014 Amyotrophic lateral sclerosis     120229702 (SOD1)    05016 Huntington disease     120229702 (SOD1)    05020 Prion disease     120229702 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     120229702 (SOD1) Enzymes [BR:hhv01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      120229702 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  120229702 NCBI-ProteinID:  XP_039084793 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGIIHFVQKEKEHVVVSGTITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPQSKKHGGPKDEERHVGDLGNVIAGKDGVANVFIEDDLIALSGERSIIGRTMVVH EKRDDLGKGGNEESTQTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggccgtgtgcgtgctgaagggccagggcccggtggaaggcatcatccac ttcgtccagaaggaaaaggagcatgttgtggtctcaggaaccatcacaggattgactgaa ggcgagcatggatttcacgtgcatcagtttggagataatacacaaggctgcaccagtgca ggtcctcactttaatcctcaatccaaaaagcatggtgggccaaaggatgaagagaggcat gttggagaccttggcaatgtaattgctggcaaggacggtgtggccaatgtgtttatagaa gatgatctgattgcgctctcaggagaacgctccatcattggccgcacaatggtggtccac gagaaacgagatgacttgggcaaaggtggaaatgaagaaagcacacaaacaggaaacgct gggagtcgtctggcatgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system