Hyaena hyaena (striped hyena): 120230571 Help Entry 120230571         CDS       T07257                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04613   Neutrophil extracellular trap formation hhv05034   Alcoholism hhv05202   Transcriptional misregulation in cancer hhv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:hhv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120230571  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     120230571   09163 Immune disease    05322 Systemic lupus erythematosus     120230571   09165 Substance dependence    05034 Alcoholism     120230571  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hhv03036]     120230571   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hhv04147]     120230571 Chromosome and associated proteins [BR:hhv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120230571 Exosome [BR:hhv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120230571 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  120230571 NCBI-ProteinID:  XP_039086121 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASKAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagactgcccgcaaatccaccgggggtaaagcaccgaggaagcaa ctggccacaaaagccgctcgcaagagtgcgccctctaccggaggggtgaagaagcctcac cgctacaggcctggcaccgtggcactccgtgaaatcagacgttatcagaagtccactgaa cttctgatccgcaaactccctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagacctgcgcttccagagcgcggccatcggtgctttgcaggaggccagcaaggcctac ctggtgggcctttttgaagacaccaacctgtgcgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcgcgccgcatacgtggagagcgcgcctaa

DBGET integrated database retrieval system