Hyaena hyaena (striped hyena): 120231052 Help Entry 120231052         CDS       T07257                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism hhv  Hyaena hyaena (striped hyena) Pathway hhv04060   Cytokine-cytokine receptor interaction hhv04061   Viral protein interaction with cytokine and cytokine receptor hhv04062   Chemokine signaling pathway hhv04064   NF-kappa B signaling pathway hhv04072   Phospholipase D signaling pathway hhv04218   Cellular senescence hhv04620   Toll-like receptor signaling pathway hhv04621   NOD-like receptor signaling pathway hhv04622   RIG-I-like receptor signaling pathway hhv04657   IL-17 signaling pathway hhv04932   Non-alcoholic fatty liver disease hhv04933   AGE-RAGE signaling pathway in diabetic complications hhv04936   Alcoholic liver disease hhv05132   Salmonella infection hhv05133   Pertussis hhv05134   Legionellosis hhv05135   Yersinia infection hhv05142   Chagas disease hhv05144   Malaria hhv05146   Amoebiasis hhv05161   Hepatitis B hhv05163   Human cytomegalovirus infection hhv05164   Influenza A hhv05167   Kaposi sarcoma-associated herpesvirus infection hhv05171   Coronavirus disease - COVID-19 hhv05200   Pathways in cancer hhv05202   Transcriptional misregulation in cancer hhv05219   Bladder cancer hhv05323   Rheumatoid arthritis hhv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hhv00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     120231052 (CXCL8)    04072 Phospholipase D signaling pathway     120231052 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120231052 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     120231052 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     120231052 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120231052 (CXCL8)    04621 NOD-like receptor signaling pathway     120231052 (CXCL8)    04622 RIG-I-like receptor signaling pathway     120231052 (CXCL8)    04657 IL-17 signaling pathway     120231052 (CXCL8)    04062 Chemokine signaling pathway     120231052 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120231052 (CXCL8)    05202 Transcriptional misregulation in cancer     120231052 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     120231052 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     120231052 (CXCL8)    05171 Coronavirus disease - COVID-19     120231052 (CXCL8)    05164 Influenza A     120231052 (CXCL8)    05163 Human cytomegalovirus infection     120231052 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     120231052 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     120231052 (CXCL8)    05135 Yersinia infection     120231052 (CXCL8)    05133 Pertussis     120231052 (CXCL8)    05134 Legionellosis     120231052 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     120231052 (CXCL8)    05144 Malaria     120231052 (CXCL8)    05142 Chagas disease     120231052 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     120231052 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120231052 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120231052 (CXCL8)    04932 Non-alcoholic fatty liver disease     120231052 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     120231052 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hhv04052]     120231052 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:hhv00536]     120231052 (CXCL8) Cytokines and neuropeptides [BR:hhv04052]  Cytokines   Chemokines    120231052 (CXCL8) Glycosaminoglycan binding proteins [BR:hhv00536]  Heparan sulfate / Heparin   Chemokines    120231052 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  120231052 NCBI-ProteinID:  XP_039086854 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MTSKLAVVLLAAVMLSAALCEAAVLSRMSSELRCQCIKTHSTPFHPKFIKELTVIDSGPH CENSEIIVKLTNEKEVCLDPKERWVQKVVEIFLKKAEKQNS NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggctgttgttctcttagcagctgttatgctttctgcagctctttgt gaagctgcagttctgtcaagaatgagttcagaacttcgatgccagtgcataaaaactcat tccacacctttccatccgaaatttatcaaagaactgacagtgattgacagtggcccacac tgtgaaaactcagaaatcattgtaaagctcaccaatgaaaaagaggtgtgcctggacccc aaggaaagatgggtgcagaaggttgtggagatatttttgaagaaagctgagaaacaaaat tcatga

DBGET integrated database retrieval system