KEGG   Hyaena hyaena (striped hyena): 120231522
Entry
120231522         CDS       T07257                                 
Name
(RefSeq) cytochrome c oxidase subunit 7A-related protein, mitochondrial
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
hhv  Hyaena hyaena (striped hyena)
Pathway
hhv00190  Oxidative phosphorylation
hhv01100  Metabolic pathways
hhv04260  Cardiac muscle contraction
hhv04714  Thermogenesis
hhv04932  Non-alcoholic fatty liver disease
hhv05010  Alzheimer disease
hhv05012  Parkinson disease
hhv05014  Amyotrophic lateral sclerosis
hhv05016  Huntington disease
hhv05020  Prion disease
hhv05022  Pathways of neurodegeneration - multiple diseases
hhv05208  Chemical carcinogenesis - reactive oxygen species
hhv05415  Diabetic cardiomyopathy
Module
hhv_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hhv00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    120231522
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    120231522
  09159 Environmental adaptation
   04714 Thermogenesis
    120231522
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    120231522
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    120231522
   05012 Parkinson disease
    120231522
   05014 Amyotrophic lateral sclerosis
    120231522
   05016 Huntington disease
    120231522
   05020 Prion disease
    120231522
   05022 Pathways of neurodegeneration - multiple diseases
    120231522
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    120231522
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    120231522
SSDB
Motif
Pfam: COX7a
Other DBs
NCBI-GeneID: 120231522
NCBI-ProteinID: XP_039087605
LinkDB
Position
Unknown
AA seq 114 aa
MYYKFSGFTQKLTGTWASDAYSPQGLRPVVSTEAPPIIFATPTKLSSDFTAYDYAGKNKV
PELQKFFQKSDGVPIHLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
NT seq 345 nt   +upstreamnt  +downstreamnt
atgtattacaagtttagtggcttcacgcagaagttgactggaacatgggcttccgacgct
tatagcccgcagggattaaggcctgtggtttccacagaagcaccacctatcatatttgcc
acacccaccaaactgagttcagattttactgcatatgattatgctgggaaaaacaaagtt
cccgagctgcagaagtttttccagaagtccgacggtgtgcccatccacctgaaacgaggc
ctgcctgaccaaatgctataccggaccaccatggcgctgacggtgggagggaccatctac
tgcctgattgctctctacatggcttcccagcccaaaaacaaatga

DBGET integrated database retrieval system